Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 78091..78716 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP122878 | ||
| Organism | Escherichia coli strain ETEC1717 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QDX11_RS26335 | Protein ID | WP_000911317.1 |
| Coordinates | 78318..78716 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | L4J1D2 |
| Locus tag | QDX11_RS26330 | Protein ID | WP_000450532.1 |
| Coordinates | 78091..78318 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX11_RS26325 (73775) | 73775..78009 | - | 4235 | Protein_86 | conjugative transfer relaxase/helicase TraI | - |
| QDX11_RS26330 (78091) | 78091..78318 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| QDX11_RS26335 (78318) | 78318..78716 | + | 399 | WP_000911317.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QDX11_RS26340 (78868) | 78868..80058 | - | 1191 | Protein_89 | type IV conjugative transfer system coupling protein TraD | - |
| QDX11_RS26345 (80309) | 80309..81040 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
| QDX11_RS26350 (81072) | 81072..81569 | - | 498 | WP_032084504.1 | entry exclusion protein | - |
| QDX11_RS26355 (81585) | 81585..82619 | - | 1035 | Protein_92 | conjugal transfer protein TraG | - |
| QDX11_RS26360 (82617) | 82617..83048 | + | 432 | Protein_93 | transposase | - |
| QDX11_RS26365 (83346) | 83346..83516 | + | 171 | WP_227432179.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..102368 | 102368 | |
| - | flank | IS/Tn | - | - | 82605..83048 | 443 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14857.14 Da Isoelectric Point: 8.5264
>T278173 WP_000911317.1 NZ_CP122878:78318-78716 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|