Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 18194..18786 Replicon plasmid unnamed1
Accession NZ_CP122877
Organism Escherichia coli strain ETEC1717

Toxin (Protein)


Gene name hicA Uniprot ID J7LNC2
Locus tag QDX11_RS25725 Protein ID WP_000520550.1
Coordinates 18538..18786 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID V0AWG0
Locus tag QDX11_RS25720 Protein ID WP_000681613.1
Coordinates 18194..18541 (-) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX11_RS25690 (QDX11_25690) 14194..14520 - 327 WP_000008645.1 TrbC/VirB2 family protein -
QDX11_RS25695 (QDX11_25695) 14534..15154 - 621 WP_000157548.1 lytic transglycosylase domain-containing protein -
QDX11_RS25700 (QDX11_25700) 15514..15747 - 234 WP_000120384.1 EexN family lipoprotein -
QDX11_RS25705 (QDX11_25705) 15752..16018 - 267 WP_000134734.1 hypothetical protein -
QDX11_RS25710 (QDX11_25710) 16095..17324 - 1230 WP_024225926.1 DNA relaxase/nickase TaxC -
QDX11_RS25715 (QDX11_25715) 17328..17831 - 504 WP_000781817.1 DNA distortion polypeptide 1 -
QDX11_RS25720 (QDX11_25720) 18194..18541 - 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QDX11_RS25725 (QDX11_25725) 18538..18786 - 249 WP_000520550.1 type II toxin-antitoxin system HicA family toxin Toxin
QDX11_RS25730 (QDX11_25730) 19091..19441 - 351 WP_000854257.1 hypothetical protein -
QDX11_RS25735 (QDX11_25735) 19535..19834 - 300 WP_000650312.1 hypothetical protein -
QDX11_RS25740 (QDX11_25740) 20288..20515 - 228 WP_000801440.1 hypothetical protein -
QDX11_RS25745 (QDX11_25745) 20505..20753 - 249 WP_001230706.1 hypothetical protein -
QDX11_RS25750 (QDX11_25750) 20750..21292 - 543 WP_001083907.1 hypothetical protein -
QDX11_RS25755 (QDX11_25755) 21397..21912 - 516 WP_001025395.1 J domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B / ant(3'')-Ia / lnu(G) - 1..46607 46607


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9437.05 Da        Isoelectric Point: 10.4800

>T278167 WP_000520550.1 NZ_CP122877:c18786-18538 [Escherichia coli]
MGKTDKLQAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
LL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13113.84 Da        Isoelectric Point: 4.6723

>AT278167 WP_000681613.1 NZ_CP122877:c18541-18194 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNVLYGKLAFIRDLVTYEASTLAELEQEFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSNHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6Y5WGJ7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CLC1

References