Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 74473..75098 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP122874 | ||
| Organism | Escherichia coli strain ETEC1718 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QDX06_RS26275 | Protein ID | WP_000911317.1 |
| Coordinates | 74700..75098 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | L4J1D2 |
| Locus tag | QDX06_RS26270 | Protein ID | WP_000450532.1 |
| Coordinates | 74473..74700 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX06_RS26265 (70157) | 70157..74391 | - | 4235 | Protein_81 | conjugative transfer relaxase/helicase TraI | - |
| QDX06_RS26270 (74473) | 74473..74700 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| QDX06_RS26275 (74700) | 74700..75098 | + | 399 | WP_000911317.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QDX06_RS26280 (75250) | 75250..76440 | - | 1191 | Protein_84 | type IV conjugative transfer system coupling protein TraD | - |
| QDX06_RS26285 (76691) | 76691..77422 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
| QDX06_RS26290 (77454) | 77454..77951 | - | 498 | WP_032084504.1 | entry exclusion protein | - |
| QDX06_RS26295 (77967) | 77967..79001 | - | 1035 | Protein_87 | conjugal transfer protein TraG | - |
| QDX06_RS26300 (78999) | 78999..79430 | + | 432 | Protein_88 | transposase | - |
| QDX06_RS26305 (79728) | 79728..79898 | + | 171 | WP_227432179.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..102370 | 102370 | |
| - | flank | IS/Tn | - | - | 78987..79430 | 443 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14857.14 Da Isoelectric Point: 8.5264
>T278153 WP_000911317.1 NZ_CP122874:74700-75098 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|