Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 26780..27372 Replicon plasmid unnamed1
Accession NZ_CP122873
Organism Escherichia coli strain ETEC1718

Toxin (Protein)


Gene name hicA Uniprot ID J7LNC2
Locus tag QDX06_RS25755 Protein ID WP_000520550.1
Coordinates 26780..27028 (+) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID V0AWG0
Locus tag QDX06_RS25760 Protein ID WP_000681613.1
Coordinates 27025..27372 (+) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX06_RS25725 (QDX06_25725) 23654..24169 + 516 WP_001025395.1 J domain-containing protein -
QDX06_RS25730 (QDX06_25730) 24274..24816 + 543 WP_001083907.1 hypothetical protein -
QDX06_RS25735 (QDX06_25735) 24813..25061 + 249 WP_001230706.1 hypothetical protein -
QDX06_RS25740 (QDX06_25740) 25051..25278 + 228 WP_000801440.1 hypothetical protein -
QDX06_RS25745 (QDX06_25745) 25732..26031 + 300 WP_000650312.1 hypothetical protein -
QDX06_RS25750 (QDX06_25750) 26125..26475 + 351 WP_000854257.1 hypothetical protein -
QDX06_RS25755 (QDX06_25755) 26780..27028 + 249 WP_000520550.1 type II toxin-antitoxin system HicA family toxin Toxin
QDX06_RS25760 (QDX06_25760) 27025..27372 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QDX06_RS25765 (QDX06_25765) 27735..28238 + 504 WP_000781817.1 DNA distortion polypeptide 1 -
QDX06_RS25770 (QDX06_25770) 28242..29471 + 1230 WP_024225926.1 DNA relaxase/nickase TaxC -
QDX06_RS25775 (QDX06_25775) 29548..29814 + 267 WP_000134734.1 hypothetical protein -
QDX06_RS25780 (QDX06_25780) 29819..30052 + 234 WP_000120384.1 EexN family lipoprotein -
QDX06_RS25785 (QDX06_25785) 30412..31032 + 621 WP_000157548.1 lytic transglycosylase domain-containing protein -
QDX06_RS25790 (QDX06_25790) 31046..31372 + 327 WP_000008645.1 TrbC/VirB2 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B / lnu(G) / ant(3'')-Ia - 1..43949 43949


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9437.05 Da        Isoelectric Point: 10.4800

>T278148 WP_000520550.1 NZ_CP122873:26780-27028 [Escherichia coli]
MGKTDKLQAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
LL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13113.84 Da        Isoelectric Point: 4.6723

>AT278148 WP_000681613.1 NZ_CP122873:27025-27372 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNVLYGKLAFIRDLVTYEASTLAELEQEFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSNHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6Y5WGJ7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CLC1

References