Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 24813..25278 Replicon plasmid unnamed1
Accession NZ_CP122873
Organism Escherichia coli strain ETEC1718

Toxin (Protein)


Gene name TsxA Uniprot ID M7C8T2
Locus tag QDX06_RS25735 Protein ID WP_001230706.1
Coordinates 24813..25061 (+) Length 83 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag QDX06_RS25740 Protein ID WP_000801440.1
Coordinates 25051..25278 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX06_RS25705 (QDX06_25705) 20294..20821 - 528 WP_000577045.1 DUF2726 domain-containing protein -
QDX06_RS25710 (QDX06_25710) 20957..21361 - 405 WP_001329491.1 hypothetical protein -
QDX06_RS25715 (QDX06_25715) 21374..21610 - 237 WP_071699791.1 RepB family plasmid replication initiator protein -
QDX06_RS25720 (QDX06_25720) 21607..22155 - 549 WP_000729198.1 replication initiation protein -
QDX06_RS25725 (QDX06_25725) 23654..24169 + 516 WP_001025395.1 J domain-containing protein -
QDX06_RS25730 (QDX06_25730) 24274..24816 + 543 WP_001083907.1 hypothetical protein -
QDX06_RS25735 (QDX06_25735) 24813..25061 + 249 WP_001230706.1 hypothetical protein Toxin
QDX06_RS25740 (QDX06_25740) 25051..25278 + 228 WP_000801440.1 hypothetical protein Antitoxin
QDX06_RS25745 (QDX06_25745) 25732..26031 + 300 WP_000650312.1 hypothetical protein -
QDX06_RS25750 (QDX06_25750) 26125..26475 + 351 WP_000854257.1 hypothetical protein -
QDX06_RS25755 (QDX06_25755) 26780..27028 + 249 WP_000520550.1 type II toxin-antitoxin system HicA family toxin -
QDX06_RS25760 (QDX06_25760) 27025..27372 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
QDX06_RS25765 (QDX06_25765) 27735..28238 + 504 WP_000781817.1 DNA distortion polypeptide 1 -
QDX06_RS25770 (QDX06_25770) 28242..29471 + 1230 WP_024225926.1 DNA relaxase/nickase TaxC -
QDX06_RS25775 (QDX06_25775) 29548..29814 + 267 WP_000134734.1 hypothetical protein -
QDX06_RS25780 (QDX06_25780) 29819..30052 + 234 WP_000120384.1 EexN family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B / lnu(G) / ant(3'')-Ia - 1..43949 43949


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9594.94 Da        Isoelectric Point: 7.9925

>T278147 WP_001230706.1 NZ_CP122873:24813-25061 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ET

Download         Length: 249 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT278147 WP_000801440.1 NZ_CP122873:25051-25278 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M7C8T2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References