Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3836775..3837393 | Replicon | chromosome |
Accession | NZ_CP122872 | ||
Organism | Escherichia coli strain ETEC1718 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QDX06_RS19310 | Protein ID | WP_001291435.1 |
Coordinates | 3837175..3837393 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QDX06_RS19305 | Protein ID | WP_000344800.1 |
Coordinates | 3836775..3837149 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX06_RS19295 (3831864) | 3831864..3833057 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDX06_RS19300 (3833080) | 3833080..3836229 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QDX06_RS19305 (3836775) | 3836775..3837149 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QDX06_RS19310 (3837175) | 3837175..3837393 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QDX06_RS19315 (3837565) | 3837565..3838116 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QDX06_RS19320 (3838232) | 3838232..3838702 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QDX06_RS19325 (3838866) | 3838866..3840416 | + | 1551 | WP_094336394.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QDX06_RS19330 (3840458) | 3840458..3840811 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QDX06_RS19340 (3841190) | 3841190..3841501 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QDX06_RS19345 (3841532) | 3841532..3842104 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278144 WP_001291435.1 NZ_CP122872:3837175-3837393 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT278144 WP_000344800.1 NZ_CP122872:3836775-3837149 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |