Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1011842..1012425 | Replicon | chromosome |
Accession | NZ_CP122872 | ||
Organism | Escherichia coli strain ETEC1718 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | QDX06_RS04870 | Protein ID | WP_000254738.1 |
Coordinates | 1012090..1012425 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QDX06_RS04865 | Protein ID | WP_000581937.1 |
Coordinates | 1011842..1012090 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX06_RS04855 (1008181) | 1008181..1009482 | + | 1302 | WP_112842795.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QDX06_RS04860 (1009530) | 1009530..1011764 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QDX06_RS04865 (1011842) | 1011842..1012090 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QDX06_RS04870 (1012090) | 1012090..1012425 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
QDX06_RS04875 (1012496) | 1012496..1013287 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QDX06_RS04880 (1013515) | 1013515..1015152 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QDX06_RS04885 (1015240) | 1015240..1016538 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T278138 WP_000254738.1 NZ_CP122872:1012090-1012425 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|