278130

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 57262..57797 Replicon plasmid unnamed3
Accession NZ_CP122871
Organism Escherichia coli strain ETEC1721

Toxin (Protein)


Gene name relE Uniprot ID Q60228
Locus tag QDX04_RS23830 Protein ID WP_001270417.1
Coordinates 57262..57549 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID L4J0V6
Locus tag QDX04_RS23835 Protein ID WP_001132895.1
Coordinates 57546..57797 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX04_RS23800 (52807) 52807..52916 + 110 Protein_52 IS5/IS1182 family transposase -
QDX04_RS23805 (53439) 53439..53689 + 251 Protein_53 type II toxin-antitoxin system ParD family antitoxin -
QDX04_RS23810 (53676) 53676..53970 + 295 Protein_54 type II toxin-antitoxin system RelE/ParE family toxin -
QDX04_RS23815 (54333) 54333..55073 + 741 WP_001066942.1 tyrosine-type recombinase/integrase -
QDX04_RS23820 (55358) 55358..56335 - 978 WP_000361610.1 RepB family plasmid replication initiator protein -
QDX04_RS23825 (57015) 57015..57260 - 246 Protein_57 integrase core domain-containing protein -
QDX04_RS23830 (57262) 57262..57549 - 288 WP_001270417.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDX04_RS23835 (57546) 57546..57797 - 252 WP_001132895.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDX04_RS23840 (57970) 57970..58182 - 213 WP_000402944.1 hypothetical protein -
QDX04_RS23845 (58556) 58556..59761 + 1206 WP_000817634.1 AAA family ATPase -
QDX04_RS23850 (59758) 59758..60720 + 963 WP_000756327.1 ParB family protein -
QDX04_RS23855 (60954) 60954..61731 + 778 Protein_63 transposase DNA-binding-containing protein -
QDX04_RS23860 (61861) 61861..61944 - 84 Protein_64 DUF4113 domain-containing protein -
QDX04_RS23865 (61946) 61946..62474 + 529 Protein_65 DUF1281 domain-containing protein -
QDX04_RS23870 (62471) 62471..62782 + 312 WP_001309256.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - eltB / eltA 1..112141 112141


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11214.24 Da        Isoelectric Point: 10.4703

>T278130 WP_001270417.1 NZ_CP122871:c57549-57262 [Escherichia coli]
MRYQVKFREDALKEWQKLDKAIQQQFAKKLKKCCDNPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDEQLIIAVVAVGK
RERSDVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9178.47 Da        Isoelectric Point: 4.2108

>AT278130 WP_001132895.1 NZ_CP122871:c57797-57546 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGFPVAILNRNQPAFYCVPAELYEKMLDALDDQELVKLVAERSNQPLHDVDLD
KYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5T8BSB4

Antitoxin

Source ID Structure
AlphaFold DB L4J0V6

References