Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 12755..13302 Replicon plasmid unnamed3
Accession NZ_CP122871
Organism Escherichia coli strain ETEC1721

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag QDX04_RS23610 Protein ID WP_001384452.1
Coordinates 13024..13302 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A2I6FMZ7
Locus tag QDX04_RS23605 Protein ID WP_000079930.1
Coordinates 12755..13024 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX04_RS23575 (7866) 7866..8177 - 312 WP_000765906.1 hypothetical protein -
- (8473) 8473..8534 - 62 NuclAT_1 - -
- (8473) 8473..8534 - 62 NuclAT_1 - -
- (8473) 8473..8534 - 62 NuclAT_1 - -
- (8473) 8473..8534 - 62 NuclAT_1 - -
QDX04_RS23585 (9839) 9839..9979 + 141 WP_064717426.1 Hok/Gef family protein -
QDX04_RS23590 (10259) 10259..10516 + 258 WP_000083834.1 replication regulatory protein RepA -
QDX04_RS23595 (10750) 10750..10824 + 75 WP_032319616.1 RepA leader peptide Tap -
QDX04_RS23600 (10817) 10817..11839 + 1023 WP_000840938.1 plasmid replication initiator RepA -
QDX04_RS23605 (12755) 12755..13024 + 270 WP_000079930.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QDX04_RS23610 (13024) 13024..13302 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
QDX04_RS23615 (13348) 13348..14077 + 730 Protein_15 3'-5' exonuclease -
QDX04_RS23620 (14084) 14084..14392 - 309 Protein_16 integrase core domain-containing protein -
QDX04_RS23625 (14409) 14409..15485 - 1077 WP_039022834.1 IS110-like element ISEc21 family transposase -
QDX04_RS23630 (15767) 15767..16626 - 860 Protein_18 IS3 family transposase -
QDX04_RS23635 (16740) 16740..17135 - 396 Protein_19 ATP-binding protein -
QDX04_RS23640 (17483) 17483..17857 - 375 WP_015675362.1 heat-labile enterotoxin LT subunit B -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - eltB / eltA 1..112141 112141
- inside IScluster/Tn - eltB / eltA 2130..27610 25480


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T278129 WP_001384452.1 NZ_CP122871:13024-13302 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2055

>AT278129 WP_000079930.1 NZ_CP122871:12755-13024 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVADK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A2I6FMZ7

References