278128

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 20744..21245 Replicon plasmid unnamed2
Accession NZ_CP122870
Organism Escherichia coli strain ETEC1721

Toxin (Protein)


Gene name TsxA Uniprot ID A0A6X6XTU7
Locus tag QDX04_RS23285 Protein ID WP_000702245.1
Coordinates 20985..21245 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag QDX04_RS23280 Protein ID WP_001132407.1
Coordinates 20744..20995 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX04_RS23235 (QDX04_23235) 15807..16514 + 708 WP_000108795.1 hypothetical protein -
QDX04_RS23240 (QDX04_23240) 16534..16656 + 123 Protein_15 hypothetical protein -
QDX04_RS23245 (QDX04_23245) 16977..17180 + 204 WP_000224735.1 hypothetical protein -
QDX04_RS23250 (QDX04_23250) 17182..17360 + 179 Protein_17 hypothetical protein -
QDX04_RS23255 (QDX04_23255) 17694..18014 + 321 WP_001401701.1 hypothetical protein -
QDX04_RS23260 (QDX04_23260) 18145..18582 - 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
QDX04_RS23265 (QDX04_23265) 18607..18789 - 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
QDX04_RS23270 (QDX04_23270) 19086..19529 + 444 WP_000192626.1 hypothetical protein -
QDX04_RS23275 (QDX04_23275) 19916..20194 - 279 WP_000545937.1 hypothetical protein -
QDX04_RS23280 (QDX04_23280) 20744..20995 - 252 WP_001132407.1 transcriptional regulator Antitoxin
QDX04_RS23285 (QDX04_23285) 20985..21245 - 261 WP_000702245.1 hypothetical protein Toxin
QDX04_RS23290 (QDX04_23290) 21297..21521 - 225 WP_000814383.1 hypothetical protein -
QDX04_RS23295 (QDX04_23295) 21619..21828 - 210 WP_000866037.1 hypothetical protein -
QDX04_RS23300 (QDX04_23300) 21869..22192 - 324 WP_000427402.1 hypothetical protein -
QDX04_RS23305 (QDX04_23305) 22773..23102 - 330 WP_000855121.1 hypothetical protein -
QDX04_RS23310 (QDX04_23310) 23700..24365 + 666 WP_000532148.1 division plane positioning ATPase MipZ -
QDX04_RS23315 (QDX04_23315) 24439..24723 + 285 WP_001162371.1 hypothetical protein -
QDX04_RS23320 (QDX04_23320) 24741..25337 - 597 WP_000125165.1 ProQ/FINO family protein -
QDX04_RS23325 (QDX04_23325) 25487..25609 - 123 WP_223685802.1 Hok/Gef family protein -
QDX04_RS23330 (QDX04_23330) 25554..25706 - 153 Protein_33 DUF5431 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..60026 60026


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9818.23 Da        Isoelectric Point: 9.5163

>T278128 WP_000702245.1 NZ_CP122870:c21245-20985 [Escherichia coli]
MKIRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEEAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9404.77 Da        Isoelectric Point: 9.8120

>AT278128 WP_001132407.1 NZ_CP122870:c20995-20744 [Escherichia coli]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6X6XTU7

Antitoxin

Source ID Structure

References