Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4159286..4159881 | Replicon | chromosome |
| Accession | NZ_CP122868 | ||
| Organism | Escherichia coli strain ETEC1721 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | A0A3L3YDL1 |
| Locus tag | QDX04_RS20195 | Protein ID | WP_000239576.1 |
| Coordinates | 4159286..4159636 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | QDX04_RS20200 | Protein ID | WP_001223208.1 |
| Coordinates | 4159630..4159881 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX04_RS20175 (4154732) | 4154732..4155754 | - | 1023 | WP_001296689.1 | ABC transporter permease | - |
| QDX04_RS20180 (4155768) | 4155768..4157270 | - | 1503 | WP_282843258.1 | sugar ABC transporter ATP-binding protein | - |
| QDX04_RS20185 (4157410) | 4157410..4158366 | - | 957 | WP_097447580.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| QDX04_RS20190 (4158676) | 4158676..4159206 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| QDX04_RS20195 (4159286) | 4159286..4159636 | - | 351 | WP_000239576.1 | endoribonuclease toxin ChpB | Toxin |
| QDX04_RS20200 (4159630) | 4159630..4159881 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| QDX04_RS20205 (4160093) | 4160093..4160434 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| QDX04_RS20210 (4160437) | 4160437..4164216 | - | 3780 | WP_282843259.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12566.53 Da Isoelectric Point: 6.2232
>T278125 WP_000239576.1 NZ_CP122868:c4159636-4159286 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPIRQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPIRQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3L3YDL1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |