Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 3608341..3609030 | Replicon | chromosome |
Accession | NZ_CP122868 | ||
Organism | Escherichia coli strain ETEC1721 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | QDX04_RS17460 | Protein ID | WP_001460496.1 |
Coordinates | 3608341..3608679 (-) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | QDX04_RS17465 | Protein ID | WP_001460495.1 |
Coordinates | 3608704..3609030 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX04_RS17440 (3603431) | 3603431..3605629 | + | 2199 | WP_000667026.1 | aldehyde oxidoreductase molybdenum-binding subunit PaoC | - |
QDX04_RS17445 (3605639) | 3605639..3606595 | + | 957 | WP_000121356.1 | molybdenum cofactor insertion chaperone PaoD | - |
QDX04_RS17450 (3606646) | 3606646..3606984 | + | 339 | Protein_3415 | LysR substrate-binding domain-containing protein | - |
QDX04_RS17455 (3607343) | 3607343..3608119 | - | 777 | WP_230282996.1 | hypothetical protein | - |
QDX04_RS17460 (3608341) | 3608341..3608679 | - | 339 | WP_001460496.1 | TA system toxin CbtA family protein | Toxin |
QDX04_RS17465 (3608704) | 3608704..3609030 | - | 327 | WP_001460495.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QDX04_RS17470 (3609073) | 3609073..3609552 | - | 480 | WP_097447683.1 | DNA repair protein RadC | - |
QDX04_RS17475 (3609565) | 3609565..3610029 | - | 465 | WP_001460493.1 | antirestriction protein | - |
QDX04_RS17480 (3610090) | 3610090..3610908 | - | 819 | WP_097447684.1 | DUF932 domain-containing protein | - |
QDX04_RS17485 (3611371) | 3611371..3611994 | + | 624 | WP_001461983.1 | inovirus Gp2 family protein | - |
QDX04_RS17490 (3612113) | 3612113..3612328 | + | 216 | WP_001461982.1 | AlpA family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 3580811..3623394 | 42583 | |
- | inside | Genomic island | - | - | 3600760..3621324 | 20564 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12771.67 Da Isoelectric Point: 8.5253
>T278122 WP_001460496.1 NZ_CP122868:c3608679-3608341 [Escherichia coli]
MKTLPANQRVAKPCPPPVLVWQTLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLADAVNFLVEKYELVRIDRRGFN
CQEQSPYLRAVDILRARQATGLLRQSHHPSAR
MKTLPANQRVAKPCPPPVLVWQTLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLADAVNFLVEKYELVRIDRRGFN
CQEQSPYLRAVDILRARQATGLLRQSHHPSAR
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|