Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3419757..3420375 | Replicon | chromosome |
Accession | NZ_CP122868 | ||
Organism | Escherichia coli strain ETEC1721 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QDX04_RS16570 | Protein ID | WP_001291435.1 |
Coordinates | 3420157..3420375 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QDX04_RS16565 | Protein ID | WP_000344800.1 |
Coordinates | 3419757..3420131 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX04_RS16555 (3414846) | 3414846..3416039 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDX04_RS16560 (3416062) | 3416062..3419211 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QDX04_RS16565 (3419757) | 3419757..3420131 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QDX04_RS16570 (3420157) | 3420157..3420375 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QDX04_RS16575 (3420546) | 3420546..3421097 | + | 552 | WP_000102556.1 | maltose O-acetyltransferase | - |
QDX04_RS16580 (3421213) | 3421213..3421683 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QDX04_RS16585 (3421847) | 3421847..3423397 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QDX04_RS16590 (3423439) | 3423439..3423792 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QDX04_RS16600 (3424171) | 3424171..3424482 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QDX04_RS16605 (3424513) | 3424513..3425085 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278121 WP_001291435.1 NZ_CP122868:3420157-3420375 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT278121 WP_000344800.1 NZ_CP122868:3419757-3420131 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |