Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2485651..2486289 | Replicon | chromosome |
| Accession | NZ_CP122868 | ||
| Organism | Escherichia coli strain ETEC1721 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | QDX04_RS12085 | Protein ID | WP_000813794.1 |
| Coordinates | 2486113..2486289 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QDX04_RS12080 | Protein ID | WP_001270286.1 |
| Coordinates | 2485651..2486067 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX04_RS12060 (2480803) | 2480803..2481744 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| QDX04_RS12065 (2481745) | 2481745..2482758 | - | 1014 | WP_001542893.1 | ABC transporter ATP-binding protein | - |
| QDX04_RS12070 (2482776) | 2482776..2483921 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| QDX04_RS12075 (2484166) | 2484166..2485572 | - | 1407 | WP_000760663.1 | PLP-dependent aminotransferase family protein | - |
| QDX04_RS12080 (2485651) | 2485651..2486067 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QDX04_RS12085 (2486113) | 2486113..2486289 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QDX04_RS12090 (2486511) | 2486511..2486741 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| QDX04_RS12095 (2486833) | 2486833..2488794 | - | 1962 | WP_282843147.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QDX04_RS12100 (2488867) | 2488867..2489403 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| QDX04_RS12105 (2489495) | 2489495..2490670 | + | 1176 | WP_001583501.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2490710..2491858 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T278120 WP_000813794.1 NZ_CP122868:c2486289-2486113 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT278120 WP_001270286.1 NZ_CP122868:c2486067-2485651 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|