Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1326883..1327508 | Replicon | chromosome |
Accession | NZ_CP122868 | ||
Organism | Escherichia coli strain ETEC1721 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QDX04_RS06460 | Protein ID | WP_000911330.1 |
Coordinates | 1327110..1327508 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QDX04_RS06455 | Protein ID | WP_000450524.1 |
Coordinates | 1326883..1327110 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX04_RS06430 (1322686) | 1322686..1323156 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
QDX04_RS06435 (1323156) | 1323156..1323728 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QDX04_RS06440 (1323874) | 1323874..1324752 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QDX04_RS06445 (1324769) | 1324769..1325803 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
QDX04_RS06450 (1326016) | 1326016..1326729 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QDX04_RS06455 (1326883) | 1326883..1327110 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QDX04_RS06460 (1327110) | 1327110..1327508 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QDX04_RS06465 (1327655) | 1327655..1328518 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
QDX04_RS06470 (1328533) | 1328533..1330548 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QDX04_RS06475 (1330622) | 1330622..1331320 | + | 699 | WP_000679823.1 | esterase | - |
QDX04_RS06480 (1331430) | 1331430..1331630 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T278113 WP_000911330.1 NZ_CP122868:1327110-1327508 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|