Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1027550..1028133 | Replicon | chromosome |
Accession | NZ_CP122868 | ||
Organism | Escherichia coli strain ETEC1721 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U9XFN8 |
Locus tag | QDX04_RS05005 | Protein ID | WP_000254745.1 |
Coordinates | 1027798..1028133 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QDX04_RS05000 | Protein ID | WP_000581937.1 |
Coordinates | 1027550..1027798 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX04_RS04990 (1023889) | 1023889..1025190 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QDX04_RS04995 (1025238) | 1025238..1027472 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QDX04_RS05000 (1027550) | 1027550..1027798 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QDX04_RS05005 (1027798) | 1027798..1028133 | + | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
QDX04_RS05010 (1028204) | 1028204..1028995 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QDX04_RS05015 (1029223) | 1029223..1030860 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QDX04_RS05020 (1030948) | 1030948..1032246 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T278112 WP_000254745.1 NZ_CP122868:1027798-1028133 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYM3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LMB4 |