Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 886238..886892 | Replicon | chromosome |
Accession | NZ_CP122868 | ||
Organism | Escherichia coli strain ETEC1721 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | QDX04_RS04375 | Protein ID | WP_000244772.1 |
Coordinates | 886485..886892 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QDX04_RS04370 | Protein ID | WP_000354046.1 |
Coordinates | 886238..886504 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX04_RS04345 (881407) | 881407..882150 | + | 744 | WP_000951961.1 | SDR family oxidoreductase | - |
QDX04_RS04350 (882207) | 882207..883640 | - | 1434 | WP_001344773.1 | 6-phospho-beta-glucosidase BglA | - |
QDX04_RS04355 (883685) | 883685..883996 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
QDX04_RS04360 (884160) | 884160..884819 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QDX04_RS04365 (885015) | 885015..885995 | - | 981 | WP_000886095.1 | tRNA-modifying protein YgfZ | - |
QDX04_RS04370 (886238) | 886238..886504 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QDX04_RS04375 (886485) | 886485..886892 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
QDX04_RS04380 (886932) | 886932..887453 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QDX04_RS04385 (887565) | 887565..888461 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QDX04_RS04390 (888486) | 888486..889196 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QDX04_RS04395 (889202) | 889202..890935 | + | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T278111 WP_000244772.1 NZ_CP122868:886485-886892 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |