Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 314402..315202 | Replicon | chromosome |
Accession | NZ_CP122868 | ||
Organism | Escherichia coli strain ETEC1721 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4NNI0 |
Locus tag | QDX04_RS01480 | Protein ID | WP_000342449.1 |
Coordinates | 314675..315202 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4NNI1 |
Locus tag | QDX04_RS01475 | Protein ID | WP_001277108.1 |
Coordinates | 314402..314668 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX04_RS01455 (310060) | 310060..310728 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
QDX04_RS01460 (310721) | 310721..311779 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
QDX04_RS01465 (312024) | 312024..312878 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
QDX04_RS01470 (313149) | 313149..314252 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
QDX04_RS01475 (314402) | 314402..314668 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
QDX04_RS01480 (314675) | 314675..315202 | + | 528 | WP_000342449.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
QDX04_RS01485 (315199) | 315199..315582 | - | 384 | WP_000778795.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
QDX04_RS01490 (316006) | 316006..317115 | + | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
QDX04_RS01495 (317163) | 317163..318089 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
QDX04_RS01500 (318086) | 318086..319363 | + | 1278 | WP_000803771.1 | branched chain amino acid ABC transporter permease LivM | - |
QDX04_RS01505 (319360) | 319360..320127 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19691.70 Da Isoelectric Point: 7.7457
>T278109 WP_000342449.1 NZ_CP122868:314675-315202 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLZ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CN24 |