Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
Location | 97161..97964 | Replicon | plasmid unnamed8 |
Accession | NZ_CP122867 | ||
Organism | Escherichia coli strain ETEC1720 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A0K3X5E3 |
Locus tag | QDY31_RS26025 | Protein ID | WP_000348884.1 |
Coordinates | 97434..97964 (+) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | G3CAI7 |
Locus tag | QDY31_RS26020 | Protein ID | WP_001275013.1 |
Coordinates | 97161..97430 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY31_RS25995 (92566) | 92566..92826 | - | 261 | Protein_101 | transposase | - |
QDY31_RS26000 (92842) | 92842..94112 | + | 1271 | WP_169029802.1 | IS3-like element IS2 family transposase | - |
QDY31_RS26005 (94087) | 94087..94281 | + | 195 | WP_077881938.1 | hypothetical protein | - |
QDY31_RS26010 (94402) | 94402..95136 | + | 735 | WP_282836067.1 | tyrosine-type recombinase/integrase | - |
QDY31_RS26015 (95284) | 95284..96273 | - | 990 | WP_024201093.1 | RepB family plasmid replication initiator protein | - |
QDY31_RS26020 (97161) | 97161..97430 | + | 270 | WP_001275013.1 | DUF1778 domain-containing protein | Antitoxin |
QDY31_RS26025 (97434) | 97434..97964 | + | 531 | WP_000348884.1 | GNAT family N-acetyltransferase | Toxin |
QDY31_RS26030 (97965) | 97965..98182 | + | 218 | Protein_108 | transposase | - |
QDY31_RS26035 (98241) | 98241..98891 | - | 651 | Protein_109 | transposase zinc-binding domain-containing protein | - |
QDY31_RS26040 (98872) | 98872..99144 | - | 273 | WP_000019163.1 | hypothetical protein | - |
QDY31_RS26045 (99215) | 99215..99302 | - | 88 | Protein_111 | hypothetical protein | - |
QDY31_RS26050 (99330) | 99330..99545 | + | 216 | WP_001435544.1 | RepB family plasmid replication initiator protein | - |
QDY31_RS26055 (100393) | 100393..101025 | + | 633 | WP_000312330.1 | ParA family protein | - |
QDY31_RS26060 (101025) | 101025..101399 | + | 375 | WP_063078193.1 | hypothetical protein | - |
QDY31_RS26065 (101637) | 101637..102611 | + | 975 | WP_021534625.1 | plasmid segregation protein ParM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | estIa / hlyD / hlyD / hlyB / hlyB / hlyA / hlyC | 1..107570 | 107570 | |
- | inside | IScluster/Tn | - | - | 89111..98891 | 9780 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20320.22 Da Isoelectric Point: 6.7486
>T278107 WP_000348884.1 NZ_CP122867:97434-97964 [Escherichia coli]
MDGLRIEIFSEEVEYQLSNFDCGEEYLNTFLTDHLQRQHSSKILRGYLLVTREDRPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEVLFEVNDE
MDGLRIEIFSEEVEYQLSNFDCGEEYLNTFLTDHLQRQHSSKILRGYLLVTREDRPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEVLFEVNDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K3X5E3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G3CAI7 |