278099

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 41025..41547 Replicon plasmid unnamed6
Accession NZ_CP122865
Organism Escherichia coli strain ETEC1720

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag QDY31_RS24855 Protein ID WP_000220560.1
Coordinates 41266..41547 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag QDY31_RS24850 Protein ID WP_000121743.1
Coordinates 41025..41276 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY31_RS24815 (QDY31_24815) 36106..36768 + 663 WP_000516402.1 division plane positioning ATPase MipZ -
QDY31_RS24820 (QDY31_24820) 36866..37147 + 282 WP_001185482.1 hypothetical protein -
QDY31_RS24825 (QDY31_24825) 37172..37654 + 483 WP_282844054.1 hypothetical protein -
QDY31_RS24830 (QDY31_24830) 37687..38148 + 462 WP_282844055.1 hypothetical protein -
QDY31_RS24835 (QDY31_24835) 38145..38501 - 357 WP_052921318.1 DNA distortion polypeptide 3 -
QDY31_RS24840 (QDY31_24840) 38638..39084 - 447 WP_001074386.1 hypothetical protein -
QDY31_RS24845 (QDY31_24845) 39109..39963 - 855 WP_001239324.1 replication initiation protein -
QDY31_RS24850 (QDY31_24850) 41025..41276 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
QDY31_RS24855 (QDY31_24855) 41266..41547 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDY31_RS24860 (QDY31_24860) 41693..42016 + 324 WP_001181903.1 hypothetical protein -
QDY31_RS24865 (QDY31_24865) 42061..42306 + 246 WP_001550454.1 hypothetical protein -
QDY31_RS24870 (QDY31_24870) 42296..42511 + 216 WP_052921379.1 hypothetical protein -
QDY31_RS24875 (QDY31_24875) 42604..42933 + 330 WP_000866648.1 hypothetical protein -
QDY31_RS24880 (QDY31_24880) 42976..43155 + 180 WP_000439078.1 hypothetical protein -
QDY31_RS24885 (QDY31_24885) 43225..43374 + 150 WP_000003880.1 hypothetical protein -
QDY31_RS24890 (QDY31_24890) 43387..43659 + 273 WP_000160399.1 hypothetical protein -
QDY31_RS24895 (QDY31_24895) 43985..44530 + 546 WP_000757693.1 DNA distortion polypeptide 1 -
QDY31_RS24900 (QDY31_24900) 44533..45699 + 1167 WP_000539529.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrS1 / blaTEM-1B - 1..47684 47684


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T278099 WP_000220560.1 NZ_CP122865:41266-41547 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT278099 WP_000121743.1 NZ_CP122865:41025-41276 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References