Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 26403..27004 | Replicon | plasmid unnamed5 |
Accession | NZ_CP122864 | ||
Organism | Escherichia coli strain ETEC1720 |
Toxin (Protein)
Gene name | doc | Uniprot ID | F4TND7 |
Locus tag | QDY31_RS24255 | Protein ID | WP_001216030.1 |
Coordinates | 26403..26783 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | QDY31_RS24260 | Protein ID | WP_001190712.1 |
Coordinates | 26783..27004 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY31_RS24230 (QDY31_24230) | 21844..23328 | - | 1485 | WP_000124150.1 | terminase | - |
QDY31_RS24235 (QDY31_24235) | 23328..24521 | - | 1194 | WP_047649469.1 | hypothetical protein | - |
QDY31_RS24240 (QDY31_24240) | 24607..25059 | - | 453 | WP_016231381.1 | hypothetical protein | - |
QDY31_RS24245 (QDY31_24245) | 25148..26191 | - | 1044 | WP_047649471.1 | DUF968 domain-containing protein | - |
QDY31_RS24250 (QDY31_24250) | 26219..26398 | - | 180 | WP_000113018.1 | hypothetical protein | - |
QDY31_RS24255 (QDY31_24255) | 26403..26783 | - | 381 | WP_001216030.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QDY31_RS24260 (QDY31_24260) | 26783..27004 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QDY31_RS24265 (QDY31_24265) | 27187..28743 | + | 1557 | WP_282836031.1 | type I restriction-modification system subunit M | - |
QDY31_RS24270 (QDY31_24270) | 28740..29873 | + | 1134 | WP_282836025.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaTEM-1A / floR | - | 1..100169 | 100169 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13601.29 Da Isoelectric Point: 5.1408
>T278098 WP_001216030.1 NZ_CP122864:c26783-26403 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M1W8Q3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |