Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 17768..18411 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP122862 | ||
| Organism | Escherichia coli strain ETEC1720 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | QDY31_RS23585 | Protein ID | WP_001044768.1 |
| Coordinates | 17768..18184 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | QDY31_RS23590 | Protein ID | WP_001261287.1 |
| Coordinates | 18181..18411 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY31_RS23570 (14267) | 14267..14857 | - | 591 | WP_000194575.1 | hypothetical protein | - |
| QDY31_RS23575 (14857) | 14857..15114 | - | 258 | WP_000343085.1 | hypothetical protein | - |
| QDY31_RS23580 (15468) | 15468..17606 | + | 2139 | WP_000350638.1 | AAA family ATPase | - |
| QDY31_RS23585 (17768) | 17768..18184 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QDY31_RS23590 (18181) | 18181..18411 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QDY31_RS23595 (18707) | 18707..18979 | + | 273 | WP_061602529.1 | hypothetical protein | - |
| QDY31_RS23600 (19026) | 19026..19730 | + | 705 | WP_282836053.1 | IS6-like element IS26 family transposase | - |
| QDY31_RS23605 (19777) | 19777..20211 | - | 435 | WP_000429836.1 | Hg(II)-responsive transcriptional regulator | - |
| QDY31_RS23610 (20283) | 20283..20633 | + | 351 | WP_001294663.1 | mercuric transport protein MerT | - |
| QDY31_RS23615 (20647) | 20647..20922 | + | 276 | WP_000732292.1 | mercury resistance system periplasmic binding protein MerP | - |
| QDY31_RS23620 (20958) | 20958..21380 | + | 423 | WP_001340589.1 | organomercurial transporter MerC | - |
| QDY31_RS23625 (21432) | 21432..23126 | + | 1695 | WP_000105636.1 | mercury(II) reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | aph(3')-Ia / mef(B) / sul3 / cmlA1 / aadA2 / dfrA12 | - | 1..95798 | 95798 | |
| - | flank | IS/Tn | - | - | 19026..19730 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T278097 WP_001044768.1 NZ_CP122862:c18184-17768 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |