Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 17768..18411 Replicon plasmid unnamed3
Accession NZ_CP122862
Organism Escherichia coli strain ETEC1720

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag QDY31_RS23585 Protein ID WP_001044768.1
Coordinates 17768..18184 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag QDY31_RS23590 Protein ID WP_001261287.1
Coordinates 18181..18411 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY31_RS23570 (14267) 14267..14857 - 591 WP_000194575.1 hypothetical protein -
QDY31_RS23575 (14857) 14857..15114 - 258 WP_000343085.1 hypothetical protein -
QDY31_RS23580 (15468) 15468..17606 + 2139 WP_000350638.1 AAA family ATPase -
QDY31_RS23585 (17768) 17768..18184 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
QDY31_RS23590 (18181) 18181..18411 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QDY31_RS23595 (18707) 18707..18979 + 273 WP_061602529.1 hypothetical protein -
QDY31_RS23600 (19026) 19026..19730 + 705 WP_282836053.1 IS6-like element IS26 family transposase -
QDY31_RS23605 (19777) 19777..20211 - 435 WP_000429836.1 Hg(II)-responsive transcriptional regulator -
QDY31_RS23610 (20283) 20283..20633 + 351 WP_001294663.1 mercuric transport protein MerT -
QDY31_RS23615 (20647) 20647..20922 + 276 WP_000732292.1 mercury resistance system periplasmic binding protein MerP -
QDY31_RS23620 (20958) 20958..21380 + 423 WP_001340589.1 organomercurial transporter MerC -
QDY31_RS23625 (21432) 21432..23126 + 1695 WP_000105636.1 mercury(II) reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aph(3')-Ia / mef(B) / sul3 / cmlA1 / aadA2 / dfrA12 - 1..95798 95798
- flank IS/Tn - - 19026..19730 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T278097 WP_001044768.1 NZ_CP122862:c18184-17768 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT278097 WP_001261287.1 NZ_CP122862:c18411-18181 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References