Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3469832..3470450 | Replicon | chromosome |
| Accession | NZ_CP122859 | ||
| Organism | Escherichia coli strain ETEC1720 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QDY31_RS16980 | Protein ID | WP_001291435.1 |
| Coordinates | 3470232..3470450 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QDY31_RS16975 | Protein ID | WP_000344800.1 |
| Coordinates | 3469832..3470206 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY31_RS16965 (3464921) | 3464921..3466114 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QDY31_RS16970 (3466137) | 3466137..3469286 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| QDY31_RS16975 (3469832) | 3469832..3470206 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QDY31_RS16980 (3470232) | 3470232..3470450 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QDY31_RS16985 (3470622) | 3470622..3471173 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| QDY31_RS16990 (3471289) | 3471289..3471759 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QDY31_RS16995 (3471923) | 3471923..3473473 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QDY31_RS17000 (3473515) | 3473515..3473868 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| QDY31_RS17010 (3474247) | 3474247..3474558 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| QDY31_RS17015 (3474589) | 3474589..3475161 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278093 WP_001291435.1 NZ_CP122859:3470232-3470450 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT278093 WP_000344800.1 NZ_CP122859:3469832-3470206 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |