Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2487391..2488029 | Replicon | chromosome |
Accession | NZ_CP122859 | ||
Organism | Escherichia coli strain ETEC1720 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QDY31_RS12170 | Protein ID | WP_000813794.1 |
Coordinates | 2487853..2488029 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDY31_RS12165 | Protein ID | WP_001270286.1 |
Coordinates | 2487391..2487807 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY31_RS12145 (2482543) | 2482543..2483484 | - | 942 | WP_087905458.1 | ABC transporter permease | - |
QDY31_RS12150 (2483485) | 2483485..2484498 | - | 1014 | WP_097740840.1 | ABC transporter ATP-binding protein | - |
QDY31_RS12155 (2484516) | 2484516..2485661 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
QDY31_RS12160 (2485906) | 2485906..2487312 | - | 1407 | WP_000760585.1 | PLP-dependent aminotransferase family protein | - |
QDY31_RS12165 (2487391) | 2487391..2487807 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDY31_RS12170 (2487853) | 2487853..2488029 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDY31_RS12175 (2488251) | 2488251..2488481 | + | 231 | WP_196010979.1 | YncJ family protein | - |
QDY31_RS12180 (2488573) | 2488573..2490534 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDY31_RS12185 (2490607) | 2490607..2491143 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
QDY31_RS12190 (2491235) | 2491235..2492410 | + | 1176 | WP_001236251.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2492450..2493715 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T278092 WP_000813794.1 NZ_CP122859:c2488029-2487853 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT278092 WP_001270286.1 NZ_CP122859:c2487807-2487391 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|