Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 693787..694622 | Replicon | chromosome |
| Accession | NZ_CP122859 | ||
| Organism | Escherichia coli strain ETEC1720 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J5ZPW7 |
| Locus tag | QDY31_RS03385 | Protein ID | WP_000854722.1 |
| Coordinates | 694245..694622 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0K4A940 |
| Locus tag | QDY31_RS03380 | Protein ID | WP_001285576.1 |
| Coordinates | 693787..694155 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY31_RS03360 (691539) | 691539..692357 | + | 819 | WP_169029782.1 | DUF932 domain-containing protein | - |
| QDY31_RS03365 (692449) | 692449..692931 | + | 483 | WP_169029783.1 | antirestriction protein | - |
| QDY31_RS03370 (692947) | 692947..693423 | + | 477 | WP_053289735.1 | RadC family protein | - |
| QDY31_RS03375 (693486) | 693486..693707 | + | 222 | WP_089570377.1 | DUF987 domain-containing protein | - |
| QDY31_RS03380 (693787) | 693787..694155 | + | 369 | WP_001285576.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDY31_RS03385 (694245) | 694245..694622 | + | 378 | WP_000854722.1 | TA system toxin CbtA family protein | Toxin |
| QDY31_RS03390 (694619) | 694619..695107 | + | 489 | WP_000761669.1 | DUF5983 family protein | - |
| QDY31_RS03395 (695127) | 695127..695324 | + | 198 | WP_000445281.1 | DUF957 domain-containing protein | - |
| QDY31_RS03400 (695409) | 695409..696254 | + | 846 | WP_169029784.1 | DUF4942 domain-containing protein | - |
| QDY31_RS03410 (696554) | 696554..697060 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
| QDY31_RS03415 (697139) | 697139..698980 | - | 1842 | WP_282835911.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14103.15 Da Isoelectric Point: 8.2904
>T278081 WP_000854722.1 NZ_CP122859:694245-694622 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J5ZPW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K4A940 |