Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 55711..56264 Replicon plasmid unnamed7
Accession NZ_CP122851
Organism Escherichia coli strain ETEC1722

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag QDX00_RS25255 Protein ID WP_096217460.1
Coordinates 55980..56264 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag QDX00_RS25250 Protein ID WP_069192543.1
Coordinates 55711..55980 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX00_RS25220 (51148) 51148..51357 + 210 WP_001297500.1 hypothetical protein -
QDX00_RS25225 (51769) 51769..52395 + 627 WP_000794191.1 NYN domain-containing protein -
QDX00_RS25230 (52547) 52547..53137 + 591 WP_001375082.1 DUF2726 domain-containing protein -
QDX00_RS25235 (53377) 53377..53625 + 249 WP_000083839.1 replication regulatory protein RepA -
QDX00_RS25240 (53870) 53870..53944 + 75 WP_001365705.1 RepA leader peptide Tap -
QDX00_RS25245 (53937) 53937..54794 + 858 WP_042634321.1 incFII family plasmid replication initiator RepA -
QDX00_RS25250 (55711) 55711..55980 + 270 WP_069192543.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QDX00_RS25255 (55980) 55980..56264 + 285 WP_096217460.1 type II toxin-antitoxin system toxin YacB Toxin
QDX00_RS25260 (56231) 56231..56509 + 279 Protein_68 IS66 family insertion sequence element accessory protein TnpB -
QDX00_RS25265 (56529) 56529..58100 + 1572 WP_062873784.1 IS66-like element ISCro1 family transposase -
QDX00_RS25270 (58135) 58135..58464 - 330 Protein_70 oxidoreductase -
QDX00_RS25275 (58464) 58464..59424 - 961 Protein_71 IS3 family transposase -
QDX00_RS25280 (59812) 59812..60027 - 216 WP_015056453.1 heat-stable enterotoxin ST-II -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - estIa / hlyD / hlyB / hlyB / hlyA / hlyC 1..107571 107571
- inside IScluster/Tn - estIa 56204..81523 25319


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-84)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11043.65 Da        Isoelectric Point: 9.4120

>T278076 WP_096217460.1 NZ_CP122851:55980-56264 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVTAWHQKFRTS

Download         Length: 285 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10224.53 Da        Isoelectric Point: 6.4681

>AT278076 WP_069192543.1 NZ_CP122851:55711-55980 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVEQQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References