Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 24598..25241 Replicon plasmid unnamed5
Accession NZ_CP122849
Organism Escherichia coli strain ETEC1722

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag QDX00_RS24475 Protein ID WP_001044768.1
Coordinates 24598..25014 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag QDX00_RS24480 Protein ID WP_001261287.1
Coordinates 25011..25241 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX00_RS24460 (21097) 21097..21687 - 591 WP_000194575.1 hypothetical protein -
QDX00_RS24465 (21687) 21687..21944 - 258 WP_000343085.1 hypothetical protein -
QDX00_RS24470 (22298) 22298..24436 + 2139 WP_000350638.1 AAA family ATPase -
QDX00_RS24475 (24598) 24598..25014 - 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
QDX00_RS24480 (25011) 25011..25241 - 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QDX00_RS24485 (25537) 25537..25809 + 273 WP_061602529.1 hypothetical protein -
QDX00_RS24490 (25856) 25856..26560 + 705 WP_282836053.1 IS6-like element IS26 family transposase -
QDX00_RS24495 (26607) 26607..27041 - 435 WP_000429836.1 Hg(II)-responsive transcriptional regulator -
QDX00_RS24500 (27113) 27113..27463 + 351 WP_001294663.1 mercuric transport protein MerT -
QDX00_RS24505 (27477) 27477..27752 + 276 WP_000732292.1 mercury resistance system periplasmic binding protein MerP -
QDX00_RS24510 (27788) 27788..28210 + 423 WP_001340589.1 organomercurial transporter MerC -
QDX00_RS24515 (28262) 28262..29956 + 1695 WP_000105636.1 mercury(II) reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid aph(3')-Ia - 1..84901 84901
- flank IS/Tn - - 25856..26560 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T278075 WP_001044768.1 NZ_CP122849:c25014-24598 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT278075 WP_001261287.1 NZ_CP122849:c25241-25011 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References