Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 38787..39388 | Replicon | plasmid unnamed4 |
Accession | NZ_CP122848 | ||
Organism | Escherichia coli strain ETEC1722 |
Toxin (Protein)
Gene name | doc | Uniprot ID | F4TND7 |
Locus tag | QDX00_RS24060 | Protein ID | WP_001216030.1 |
Coordinates | 38787..39167 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | QDX00_RS24065 | Protein ID | WP_001190712.1 |
Coordinates | 39167..39388 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX00_RS24035 (QDX00_24035) | 34228..35712 | - | 1485 | WP_000124150.1 | terminase | - |
QDX00_RS24040 (QDX00_24040) | 35712..36905 | - | 1194 | WP_047649469.1 | hypothetical protein | - |
QDX00_RS24045 (QDX00_24045) | 36991..37443 | - | 453 | WP_016231381.1 | hypothetical protein | - |
QDX00_RS24050 (QDX00_24050) | 37532..38575 | - | 1044 | WP_047649471.1 | DUF968 domain-containing protein | - |
QDX00_RS24055 (QDX00_24055) | 38603..38782 | - | 180 | WP_000113018.1 | hypothetical protein | - |
QDX00_RS24060 (QDX00_24060) | 38787..39167 | - | 381 | WP_001216030.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
QDX00_RS24065 (QDX00_24065) | 39167..39388 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QDX00_RS24070 (QDX00_24070) | 39571..41127 | + | 1557 | WP_282836031.1 | type I restriction-modification system subunit M | - |
QDX00_RS24075 (QDX00_24075) | 41124..42257 | + | 1134 | WP_282836025.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaTEM-1A / floR | - | 1..98832 | 98832 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13601.29 Da Isoelectric Point: 5.1408
>T278074 WP_001216030.1 NZ_CP122848:c39167-38787 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M1W8Q3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |