Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2484391..2485029 | Replicon | chromosome |
| Accession | NZ_CP122844 | ||
| Organism | Escherichia coli strain ETEC1722 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | QDX00_RS12135 | Protein ID | WP_000813794.1 |
| Coordinates | 2484853..2485029 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QDX00_RS12130 | Protein ID | WP_001270286.1 |
| Coordinates | 2484391..2484807 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDX00_RS12110 (2479543) | 2479543..2480484 | - | 942 | WP_087905458.1 | ABC transporter permease | - |
| QDX00_RS12115 (2480485) | 2480485..2481498 | - | 1014 | WP_097740840.1 | ABC transporter ATP-binding protein | - |
| QDX00_RS12120 (2481516) | 2481516..2482661 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| QDX00_RS12125 (2482906) | 2482906..2484312 | - | 1407 | WP_000760585.1 | PLP-dependent aminotransferase family protein | - |
| QDX00_RS12130 (2484391) | 2484391..2484807 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| QDX00_RS12135 (2484853) | 2484853..2485029 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| QDX00_RS12140 (2485251) | 2485251..2485481 | + | 231 | WP_196010979.1 | YncJ family protein | - |
| QDX00_RS12145 (2485573) | 2485573..2487534 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| QDX00_RS12150 (2487607) | 2487607..2488143 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
| QDX00_RS12155 (2488235) | 2488235..2489410 | + | 1176 | WP_001236251.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2489450..2490715 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T278063 WP_000813794.1 NZ_CP122844:c2485029-2484853 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT278063 WP_001270286.1 NZ_CP122844:c2484807-2484391 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|