Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 693786..694621 | Replicon | chromosome |
Accession | NZ_CP122844 | ||
Organism | Escherichia coli strain ETEC1722 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J5ZPW7 |
Locus tag | QDX00_RS03385 | Protein ID | WP_000854722.1 |
Coordinates | 694244..694621 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A0K4A940 |
Locus tag | QDX00_RS03380 | Protein ID | WP_001285576.1 |
Coordinates | 693786..694154 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDX00_RS03360 (691538) | 691538..692356 | + | 819 | WP_169029782.1 | DUF932 domain-containing protein | - |
QDX00_RS03365 (692448) | 692448..692930 | + | 483 | WP_169029783.1 | antirestriction protein | - |
QDX00_RS03370 (692946) | 692946..693422 | + | 477 | WP_053289735.1 | RadC family protein | - |
QDX00_RS03375 (693485) | 693485..693706 | + | 222 | WP_089570377.1 | DUF987 domain-containing protein | - |
QDX00_RS03380 (693786) | 693786..694154 | + | 369 | WP_001285576.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QDX00_RS03385 (694244) | 694244..694621 | + | 378 | WP_000854722.1 | TA system toxin CbtA family protein | Toxin |
QDX00_RS03390 (694618) | 694618..695106 | + | 489 | WP_000761669.1 | DUF5983 family protein | - |
QDX00_RS03395 (695126) | 695126..695323 | + | 198 | WP_000445281.1 | DUF957 domain-containing protein | - |
QDX00_RS03400 (695408) | 695408..696253 | + | 846 | WP_169029784.1 | DUF4942 domain-containing protein | - |
QDX00_RS03410 (696553) | 696553..697059 | + | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
QDX00_RS03415 (697138) | 697138..698979 | - | 1842 | WP_282835911.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14103.15 Da Isoelectric Point: 8.2904
>T278052 WP_000854722.1 NZ_CP122844:694244-694621 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J5ZPW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0K4A940 |