Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 88086..88608 Replicon plasmid unnamed5
Accession NZ_CP122842
Organism Escherichia coli strain ETEC1729

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag QDW97_RS26510 Protein ID WP_000220560.1
Coordinates 88327..88608 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag QDW97_RS26505 Protein ID WP_000121743.1
Coordinates 88086..88337 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW97_RS26485 (83982) 83982..84347 + 366 WP_000124098.1 hypothetical protein -
QDW97_RS26490 (84347) 84347..85534 + 1188 WP_000937614.1 IS91-like element IS91 family transposase -
QDW97_RS26495 (85725) 85725..85976 - 252 Protein_94 hypothetical protein -
QDW97_RS26500 (86016) 86016..86852 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
QDW97_RS26505 (88086) 88086..88337 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
QDW97_RS26510 (88327) 88327..88608 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDW97_RS26515 (88754) 88754..89077 + 324 WP_001181907.1 hypothetical protein -
QDW97_RS26520 (89122) 89122..89367 + 246 WP_000356545.1 hypothetical protein -
QDW97_RS26525 (89357) 89357..89572 + 216 WP_001180116.1 hypothetical protein -
QDW97_RS26530 (89962) 89962..91149 - 1188 WP_000937614.1 IS91-like element IS91 family transposase -
QDW97_RS26535 (91149) 91149..91514 - 366 WP_000124098.1 hypothetical protein -
QDW97_RS26540 (91604) 91604..91795 + 192 Protein_103 hypothetical protein -
QDW97_RS26545 (91932) 91932..92288 + 357 WP_000456533.1 DNA distortion polypeptide 3 -
QDW97_RS26550 (92285) 92285..93262 - 978 WP_282843796.1 hypothetical protein -
QDW97_RS26555 (93287) 93287..93568 - 282 WP_282843797.1 CopG family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - hlyD / hlyB / hlyA / hlyC 1..120023 120023
- inside IScluster/Tn - - 84302..91194 6892


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T278044 WP_000220560.1 NZ_CP122842:88327-88608 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT278044 WP_000121743.1 NZ_CP122842:88086-88337 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References