Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 61670..62229 Replicon plasmid unnamed5
Accession NZ_CP122842
Organism Escherichia coli strain ETEC1729

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag QDW97_RS26385 Protein ID WP_000421257.1
Coordinates 61954..62229 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag QDW97_RS26380 Protein ID WP_001178089.1
Coordinates 61670..61954 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW97_RS26350 (57110) 57110..57319 + 210 WP_001297500.1 hypothetical protein -
QDW97_RS26355 (57731) 57731..58357 + 627 WP_000794191.1 NYN domain-containing protein -
QDW97_RS26360 (58509) 58509..59099 + 591 WP_001375082.1 DUF2726 domain-containing protein -
QDW97_RS26365 (59339) 59339..59587 + 249 WP_000083839.1 replication regulatory protein RepA -
QDW97_RS26370 (59832) 59832..59906 + 75 WP_001365705.1 RepA leader peptide Tap -
QDW97_RS26375 (59899) 59899..60756 + 858 WP_042634321.1 incFII family plasmid replication initiator RepA -
QDW97_RS26380 (61670) 61670..61954 + 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
QDW97_RS26385 (61954) 61954..62229 + 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDW97_RS26390 (62513) 62513..63700 - 1188 WP_000937614.1 IS91-like element IS91 family transposase -
QDW97_RS26395 (63700) 63700..64065 - 366 WP_000124098.1 hypothetical protein -
QDW97_RS26400 (64341) 64341..65528 - 1188 WP_000937591.1 IS91 family transposase -
QDW97_RS26405 (65528) 65528..65893 - 366 WP_000091308.1 hypothetical protein -
QDW97_RS26410 (66569) 66569..66910 - 342 Protein_77 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - hlyD / hlyB / hlyA / hlyC 1..120023 120023


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T278043 WP_000421257.1 NZ_CP122842:61954-62229 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10456.86 Da        Isoelectric Point: 5.6558

>AT278043 WP_001178089.1 NZ_CP122842:61670-61954 [Escherichia coli]
IQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References