Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 48547..49082 Replicon plasmid unnamed1
Accession NZ_CP122838
Organism Escherichia coli strain ETEC1729

Toxin (Protein)


Gene name relE Uniprot ID Q60228
Locus tag QDW97_RS24545 Protein ID WP_001270417.1
Coordinates 48547..48834 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID L4J0V6
Locus tag QDW97_RS24550 Protein ID WP_001132895.1
Coordinates 48831..49082 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDW97_RS24515 (44092) 44092..44201 + 110 Protein_48 IS5/IS1182 family transposase -
QDW97_RS24520 (44724) 44724..44974 + 251 Protein_49 type II toxin-antitoxin system ParD family antitoxin -
QDW97_RS24525 (44961) 44961..45255 + 295 Protein_50 type II toxin-antitoxin system RelE/ParE family toxin -
QDW97_RS24530 (45618) 45618..46358 + 741 WP_001066942.1 tyrosine-type recombinase/integrase -
QDW97_RS24535 (46643) 46643..47620 - 978 WP_000361610.1 RepB family plasmid replication initiator protein -
QDW97_RS24540 (48300) 48300..48545 - 246 Protein_53 integrase core domain-containing protein -
QDW97_RS24545 (48547) 48547..48834 - 288 WP_001270417.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDW97_RS24550 (48831) 48831..49082 - 252 WP_001132895.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDW97_RS24555 (49255) 49255..49467 - 213 WP_000402944.1 hypothetical protein -
QDW97_RS24560 (49841) 49841..51046 + 1206 WP_000817634.1 AAA family ATPase -
QDW97_RS24565 (51043) 51043..52005 + 963 WP_000756327.1 ParB family protein -
QDW97_RS24570 (52239) 52239..53016 + 778 Protein_59 transposase DNA-binding-containing protein -
QDW97_RS24575 (53146) 53146..53229 - 84 Protein_60 DUF4113 domain-containing protein -
QDW97_RS24580 (53231) 53231..53759 + 529 Protein_61 DUF1281 domain-containing protein -
QDW97_RS24585 (53756) 53756..54067 + 312 WP_001309256.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - eltB / eltA 1..94250 94250


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11214.24 Da        Isoelectric Point: 10.4703

>T278036 WP_001270417.1 NZ_CP122838:c48834-48547 [Escherichia coli]
MRYQVKFREDALKEWQKLDKAIQQQFAKKLKKCCDNPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDEQLIIAVVAVGK
RERSDVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9178.47 Da        Isoelectric Point: 4.2108

>AT278036 WP_001132895.1 NZ_CP122838:c49082-48831 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGFPVAILNRNQPAFYCVPAELYEKMLDALDDQELVKLVAERSNQPLHDVDLD
KYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5T8BSB4

Antitoxin

Source ID Structure
AlphaFold DB L4J0V6

References