Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3562239..3563076 | Replicon | chromosome |
| Accession | NZ_CP122837 | ||
| Organism | Escherichia coli strain ETEC1729 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | - |
| Locus tag | QDW97_RS17205 | Protein ID | WP_096262872.1 |
| Coordinates | 3562534..3563076 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | QDW97_RS17200 | Protein ID | WP_001297137.1 |
| Coordinates | 3562239..3562550 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW97_RS17175 (3557259) | 3557259..3558206 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| QDW97_RS17180 (3558228) | 3558228..3560219 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| QDW97_RS17185 (3560209) | 3560209..3560823 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| QDW97_RS17190 (3560823) | 3560823..3561152 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| QDW97_RS17195 (3561164) | 3561164..3562054 | + | 891 | WP_000971336.1 | heme o synthase | - |
| QDW97_RS17200 (3562239) | 3562239..3562550 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| QDW97_RS17205 (3562534) | 3562534..3563076 | + | 543 | WP_096262872.1 | GNAT family N-acetyltransferase | Toxin |
| QDW97_RS17210 (3563132) | 3563132..3564067 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
| QDW97_RS17215 (3564475) | 3564475..3565839 | + | 1365 | WP_001000978.1 | MFS transporter | - |
| QDW97_RS17220 (3565967) | 3565967..3566458 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| QDW97_RS17225 (3566626) | 3566626..3567537 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19804.03 Da Isoelectric Point: 8.6178
>T278032 WP_096262872.1 NZ_CP122837:3562534-3563076 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSNITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSNITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|