Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3528159..3528777 | Replicon | chromosome |
Accession | NZ_CP122837 | ||
Organism | Escherichia coli strain ETEC1729 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QDW97_RS17035 | Protein ID | WP_001291435.1 |
Coordinates | 3528559..3528777 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QDW97_RS17030 | Protein ID | WP_000344800.1 |
Coordinates | 3528159..3528533 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW97_RS17020 (3523247) | 3523247..3524440 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QDW97_RS17025 (3524463) | 3524463..3527613 | + | 3151 | Protein_3331 | efflux RND transporter permease AcrB | - |
QDW97_RS17030 (3528159) | 3528159..3528533 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QDW97_RS17035 (3528559) | 3528559..3528777 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QDW97_RS17040 (3528949) | 3528949..3529500 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QDW97_RS17045 (3529616) | 3529616..3530086 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QDW97_RS17050 (3530250) | 3530250..3531800 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QDW97_RS17055 (3531842) | 3531842..3532195 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
QDW97_RS17065 (3532574) | 3532574..3532885 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QDW97_RS17070 (3532916) | 3532916..3533488 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278031 WP_001291435.1 NZ_CP122837:3528559-3528777 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT278031 WP_000344800.1 NZ_CP122837:3528159-3528533 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |