Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2560631..2561269 | Replicon | chromosome |
Accession | NZ_CP122837 | ||
Organism | Escherichia coli strain ETEC1729 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QDW97_RS12335 | Protein ID | WP_000813794.1 |
Coordinates | 2561093..2561269 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDW97_RS12330 | Protein ID | WP_001270286.1 |
Coordinates | 2560631..2561047 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW97_RS12310 (2555784) | 2555784..2556725 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
QDW97_RS12315 (2556726) | 2556726..2557739 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
QDW97_RS12320 (2557757) | 2557757..2558902 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
QDW97_RS12325 (2559147) | 2559147..2560552 | - | 1406 | Protein_2415 | PLP-dependent aminotransferase family protein | - |
QDW97_RS12330 (2560631) | 2560631..2561047 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDW97_RS12335 (2561093) | 2561093..2561269 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDW97_RS12340 (2561491) | 2561491..2561721 | + | 231 | WP_000494239.1 | YncJ family protein | - |
QDW97_RS12345 (2561813) | 2561813..2563774 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDW97_RS12350 (2563847) | 2563847..2564383 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
QDW97_RS12355 (2564475) | 2564475..2565650 | + | 1176 | WP_001236258.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T278030 WP_000813794.1 NZ_CP122837:c2561269-2561093 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT278030 WP_001270286.1 NZ_CP122837:c2561047-2560631 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|