Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1437064..1437689 | Replicon | chromosome |
Accession | NZ_CP122837 | ||
Organism | Escherichia coli strain ETEC1729 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | QDW97_RS07005 | Protein ID | WP_000911329.1 |
Coordinates | 1437291..1437689 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | QDW97_RS07000 | Protein ID | WP_000450524.1 |
Coordinates | 1437064..1437291 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW97_RS06975 (1432866) | 1432866..1433336 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
QDW97_RS06980 (1433336) | 1433336..1433908 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
QDW97_RS06985 (1434054) | 1434054..1434932 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
QDW97_RS06990 (1434949) | 1434949..1435983 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
QDW97_RS06995 (1436196) | 1436196..1436909 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
QDW97_RS07000 (1437064) | 1437064..1437291 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QDW97_RS07005 (1437291) | 1437291..1437689 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QDW97_RS07010 (1437836) | 1437836..1438699 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
QDW97_RS07015 (1438714) | 1438714..1440729 | + | 2016 | WP_000829393.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
QDW97_RS07020 (1440803) | 1440803..1441501 | + | 699 | WP_000679812.1 | esterase | - |
QDW97_RS07025 (1441611) | 1441611..1441811 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T278024 WP_000911329.1 NZ_CP122837:1437291-1437689 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |