Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1007906..1008560 | Replicon | chromosome |
Accession | NZ_CP122837 | ||
Organism | Escherichia coli strain ETEC1729 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | QDW97_RS04980 | Protein ID | WP_000244781.1 |
Coordinates | 1008153..1008560 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QDW97_RS04975 | Protein ID | WP_000354046.1 |
Coordinates | 1007906..1008172 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW97_RS04955 (1003994) | 1003994..1005427 | - | 1434 | WP_139501107.1 | 6-phospho-beta-glucosidase BglA | - |
QDW97_RS04960 (1005472) | 1005472..1005783 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
QDW97_RS04965 (1005947) | 1005947..1006606 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QDW97_RS04970 (1006683) | 1006683..1007663 | - | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
QDW97_RS04975 (1007906) | 1007906..1008172 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QDW97_RS04980 (1008153) | 1008153..1008560 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
QDW97_RS04985 (1008600) | 1008600..1009121 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QDW97_RS04990 (1009233) | 1009233..1010129 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QDW97_RS04995 (1010154) | 1010154..1010864 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QDW97_RS05000 (1010870) | 1010870..1012603 | + | 1734 | WP_096262898.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T278023 WP_000244781.1 NZ_CP122837:1008153-1008560 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|