Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 788042..788877 | Replicon | chromosome |
Accession | NZ_CP122837 | ||
Organism | Escherichia coli strain ETEC1729 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J5ZPW7 |
Locus tag | QDW97_RS03865 | Protein ID | WP_000854722.1 |
Coordinates | 788500..788877 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A8S7U9D1 |
Locus tag | QDW97_RS03860 | Protein ID | WP_024168534.1 |
Coordinates | 788042..788410 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDW97_RS03820 (783975) | 783975..784181 | + | 207 | WP_000668905.1 | hypothetical protein | - |
QDW97_RS03825 (784257) | 784257..784481 | + | 225 | WP_000459736.1 | hypothetical protein | - |
QDW97_RS03830 (784668) | 784668..784907 | + | 240 | WP_001255978.1 | hypothetical protein | - |
QDW97_RS03835 (784926) | 784926..785408 | + | 483 | WP_000649890.1 | hypothetical protein | - |
QDW97_RS03840 (785767) | 785767..786585 | + | 819 | WP_001234707.1 | DUF932 domain-containing protein | - |
QDW97_RS03845 (786677) | 786677..787162 | + | 486 | WP_000214415.1 | antirestriction protein | - |
QDW97_RS03850 (787178) | 787178..787654 | + | 477 | WP_001186725.1 | RadC family protein | - |
QDW97_RS03855 (787741) | 787741..787962 | + | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
QDW97_RS03860 (788042) | 788042..788410 | + | 369 | WP_024168534.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QDW97_RS03865 (788500) | 788500..788877 | + | 378 | WP_000854722.1 | TA system toxin CbtA family protein | Toxin |
QDW97_RS03870 (788874) | 788874..789362 | + | 489 | WP_000761669.1 | DUF5983 family protein | - |
QDW97_RS03875 (789382) | 789382..789579 | + | 198 | WP_000445281.1 | DUF957 domain-containing protein | - |
QDW97_RS03880 (789664) | 789664..790509 | + | 846 | WP_001280434.1 | DUF4942 domain-containing protein | - |
QDW97_RS03890 (790809) | 790809..791315 | + | 507 | WP_282843695.1 | G/U mismatch-specific DNA glycosylase | - |
QDW97_RS03895 (791394) | 791394..793235 | - | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14103.15 Da Isoelectric Point: 8.2904
>T278022 WP_000854722.1 NZ_CP122837:788500-788877 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQILLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|