Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 49059..49891 | Replicon | chromosome |
| Accession | NZ_CP122837 | ||
| Organism | Escherichia coli strain ETEC1729 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0H2VCF5 |
| Locus tag | QDW97_RS00255 | Protein ID | WP_000854681.1 |
| Coordinates | 49059..49436 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QDW97_RS00260 | Protein ID | WP_088474659.1 |
| Coordinates | 49526..49891 (-) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDW97_RS00225 (44698) | 44698..45621 | - | 924 | WP_000535960.1 | carboxylate/amino acid/amine transporter | - |
| QDW97_RS00230 (45732) | 45732..46917 | - | 1186 | Protein_45 | sugar efflux transporter | - |
| QDW97_RS00235 (47346) | 47346..47474 | - | 129 | Protein_46 | RhuM family protein | - |
| QDW97_RS00240 (47712) | 47712..48555 | - | 844 | Protein_47 | DUF4942 domain-containing protein | - |
| QDW97_RS00245 (48640) | 48640..48837 | - | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
| QDW97_RS00250 (48913) | 48913..49062 | - | 150 | Protein_49 | DUF5983 family protein | - |
| QDW97_RS00255 (49059) | 49059..49436 | - | 378 | WP_000854681.1 | TA system toxin CbtA family protein | Toxin |
| QDW97_RS00260 (49526) | 49526..49891 | - | 366 | WP_088474659.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QDW97_RS00265 (49969) | 49969..50190 | - | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
| QDW97_RS00270 (50253) | 50253..50729 | - | 477 | WP_001424026.1 | RadC family protein | - |
| QDW97_RS00275 (50745) | 50745..51230 | - | 486 | WP_000206658.1 | antirestriction protein | - |
| QDW97_RS00280 (51322) | 51322..52140 | - | 819 | WP_001234615.1 | DUF932 domain-containing protein | - |
| QDW97_RS00285 (52239) | 52239..52472 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| QDW97_RS00290 (52478) | 52478..53155 | - | 678 | WP_001097305.1 | hypothetical protein | - |
| QDW97_RS00295 (53303) | 53303..53983 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13963.89 Da Isoelectric Point: 7.4348
>T278019 WP_000854681.1 NZ_CP122837:c49436-49059 [Escherichia coli]
MKTLPDTHIREASHCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTSHNYRTVNNITLGKHPEAKR
MKTLPDTHIREASHCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTSHNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|