Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 36442..37085 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP122835 | ||
| Organism | Escherichia coli strain ETEC1730 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | QDY27_RS26835 | Protein ID | WP_001044768.1 |
| Coordinates | 36669..37085 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | QDY27_RS26830 | Protein ID | WP_001261287.1 |
| Coordinates | 36442..36672 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY27_RS26810 (31602) | 31602..32690 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
| QDY27_RS26815 (32692) | 32692..34917 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
| QDY27_RS26820 (34967) | 34967..35866 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
| QDY27_RS26825 (35856) | 35856..36146 | - | 291 | WP_000111771.1 | hypothetical protein | - |
| QDY27_RS26830 (36442) | 36442..36672 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QDY27_RS26835 (36669) | 36669..37085 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QDY27_RS26840 (37247) | 37247..39385 | - | 2139 | WP_000350639.1 | AAA family ATPase | - |
| QDY27_RS26845 (39893) | 39893..40597 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| QDY27_RS26850 (40660) | 40660..40755 | + | 96 | Protein_46 | helix-turn-helix domain-containing protein | - |
| QDY27_RS26855 (40938) | 40938..41798 | + | 861 | WP_000027057.1 | broad-spectrum class A beta-lactamase TEM-1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aph(3')-Ia | - | 1..104099 | 104099 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T278014 WP_001044768.1 NZ_CP122835:36669-37085 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |