278013

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 135088..135586 Replicon plasmid unnamed2
Accession NZ_CP122834
Organism Escherichia coli strain ETEC1730

Toxin (Protein)


Gene name TsxA Uniprot ID A0A764VNK7
Locus tag QDY27_RS26440 Protein ID WP_000868275.1
Coordinates 135320..135586 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID A0A3H7VMJ5
Locus tag QDY27_RS26435 Protein ID WP_001450803.1
Coordinates 135088..135330 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY27_RS26395 (130445) 130445..130780 - 336 WP_000963832.1 DUF6290 family protein -
QDY27_RS26400 (131114) 131114..131521 + 408 WP_001190622.1 hypothetical protein -
QDY27_RS26405 (131531) 131531..132292 + 762 WP_001097938.1 conjugal transfer protein TraL -
QDY27_RS26410 (132289) 132289..132993 + 705 WP_001279864.1 hypothetical protein -
QDY27_RS26415 (133022) 133022..133459 - 438 WP_000466317.1 type II toxin-antitoxin system HicB family antitoxin -
QDY27_RS26420 (133484) 133484..133666 - 183 WP_000833471.1 type II toxin-antitoxin system HicA family toxin -
QDY27_RS26425 (133862) 133862..134140 - 279 WP_000545935.1 cobalamin biosynthesis protein CbiX -
QDY27_RS26430 (134466) 134466..134648 - 183 WP_000449470.1 hypothetical protein -
QDY27_RS26435 (135088) 135088..135330 - 243 WP_001450803.1 hypothetical protein Antitoxin
QDY27_RS26440 (135320) 135320..135586 - 267 WP_000868275.1 hypothetical protein Toxin
QDY27_RS26445 (135637) 135637..135861 - 225 WP_000749827.1 hypothetical protein -
QDY27_RS26450 (135957) 135957..136199 - 243 WP_282843560.1 hypothetical protein -
QDY27_RS26455 (136218) 136218..136583 + 366 WP_000124098.1 hypothetical protein -
QDY27_RS26460 (136583) 136583..137770 + 1188 WP_000937614.1 IS91-like element IS91 family transposase -
QDY27_RS26465 (137959) 137959..138611 + 653 Protein_148 IS4-like element IS421 family transposase -
QDY27_RS26470 (138805) 138805..139128 - 324 WP_000432878.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - hlyD / hlyC / hlyA / hlyB / hlyD 1..165083 165083


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10199.63 Da        Isoelectric Point: 9.5657

>T278013 WP_000868275.1 NZ_CP122834:c135586-135320 [Escherichia coli]
MKVRKGDRQYYLNKEGDTFHLVKRVKTFSKSATLGKTKATVITVADLIFHEDAFDTIDFTRGGLRENDKEVVSMMIQEMN
NEREKNVN

Download         Length: 267 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9288.69 Da        Isoelectric Point: 9.7120

>AT278013 WP_001450803.1 NZ_CP122834:c135330-135088 [Escherichia coli]
MLTENTPENIKRLRQKIGLTQRECAEIFSMNPRTWRRKEEPAGTASGTALTPVEFKYLQLLAGEHPEYVLRKRDKPKCSE

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A764VNK7

Antitoxin

Source ID Structure
AlphaFold DB A0A3H7VMJ5

References