Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 133022..133666 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP122834 | ||
| Organism | Escherichia coli strain ETEC1730 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7L6LII1 |
| Locus tag | QDY27_RS26420 | Protein ID | WP_000833471.1 |
| Coordinates | 133484..133666 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A7L6LHN8 |
| Locus tag | QDY27_RS26415 | Protein ID | WP_000466317.1 |
| Coordinates | 133022..133459 (-) | Length | 146 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY27_RS26395 (130445) | 130445..130780 | - | 336 | WP_000963832.1 | DUF6290 family protein | - |
| QDY27_RS26400 (131114) | 131114..131521 | + | 408 | WP_001190622.1 | hypothetical protein | - |
| QDY27_RS26405 (131531) | 131531..132292 | + | 762 | WP_001097938.1 | conjugal transfer protein TraL | - |
| QDY27_RS26410 (132289) | 132289..132993 | + | 705 | WP_001279864.1 | hypothetical protein | - |
| QDY27_RS26415 (133022) | 133022..133459 | - | 438 | WP_000466317.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QDY27_RS26420 (133484) | 133484..133666 | - | 183 | WP_000833471.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QDY27_RS26425 (133862) | 133862..134140 | - | 279 | WP_000545935.1 | cobalamin biosynthesis protein CbiX | - |
| QDY27_RS26430 (134466) | 134466..134648 | - | 183 | WP_000449470.1 | hypothetical protein | - |
| QDY27_RS26435 (135088) | 135088..135330 | - | 243 | WP_001450803.1 | hypothetical protein | - |
| QDY27_RS26440 (135320) | 135320..135586 | - | 267 | WP_000868275.1 | hypothetical protein | - |
| QDY27_RS26445 (135637) | 135637..135861 | - | 225 | WP_000749827.1 | hypothetical protein | - |
| QDY27_RS26450 (135957) | 135957..136199 | - | 243 | WP_282843560.1 | hypothetical protein | - |
| QDY27_RS26455 (136218) | 136218..136583 | + | 366 | WP_000124098.1 | hypothetical protein | - |
| QDY27_RS26460 (136583) | 136583..137770 | + | 1188 | WP_000937614.1 | IS91-like element IS91 family transposase | - |
| QDY27_RS26465 (137959) | 137959..138611 | + | 653 | Protein_148 | IS4-like element IS421 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | hlyD / hlyC / hlyA / hlyB / hlyD | 1..165083 | 165083 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6675.97 Da Isoelectric Point: 11.0013
>T278012 WP_000833471.1 NZ_CP122834:c133666-133484 [Escherichia coli]
MKSADLLKELIAAGCELKRHKASSHQIWWSPITGKTFPVPHPKKDLPLGTVRSIRKMAGI
MKSADLLKELIAAGCELKRHKASSHQIWWSPITGKTFPVPHPKKDLPLGTVRSIRKMAGI
Download Length: 183 bp
Antitoxin
Download Length: 146 a.a. Molecular weight: 16227.10 Da Isoelectric Point: 4.3135
>AT278012 WP_000466317.1 NZ_CP122834:c133459-133022 [Escherichia coli]
MFFSVGVETPKDDHTAYGITVPAFDRFDFGCVSAADTQSEIPVMAREAILAIVEEMVLSGSYSVDDIHDDGCLTYAANQD
YSHCDSWFVIDVDLSEIEGKQQRINIALPDVLIRRIDGFVRESGGVYRDRSHFLAQAARHELSYK
MFFSVGVETPKDDHTAYGITVPAFDRFDFGCVSAADTQSEIPVMAREAILAIVEEMVLSGSYSVDDIHDDGCLTYAANQD
YSHCDSWFVIDVDLSEIEGKQQRINIALPDVLIRRIDGFVRESGGVYRDRSHFLAQAARHELSYK
Download Length: 438 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6LII1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6LHN8 |