278007

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 4838..5463 Replicon plasmid unnamed2
Accession NZ_CP122834
Organism Escherichia coli strain ETEC1730

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QDY27_RS25770 Protein ID WP_000911317.1
Coordinates 5065..5463 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID L4J1D2
Locus tag QDY27_RS25765 Protein ID WP_000450532.1
Coordinates 4838..5065 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDY27_RS25730 (1) 1..963 + 963 WP_032084392.1 ParB family protein -
QDY27_RS25735 (1103) 1103..1276 - 174 Protein_2 DUF4113 domain-containing protein -
QDY27_RS25740 (1350) 1350..1775 + 426 WP_024193300.1 antirestriction protein -
QDY27_RS25745 (1812) 1812..1943 - 132 Protein_4 transposase -
QDY27_RS25750 (2132) 2132..3319 - 1188 WP_000937614.1 IS91-like element IS91 family transposase -
QDY27_RS25755 (3319) 3319..3684 - 366 WP_000124098.1 hypothetical protein -
QDY27_RS25760 (3773) 3773..4756 - 984 Protein_7 MobF family relaxase -
QDY27_RS25765 (4838) 4838..5065 + 228 WP_000450532.1 toxin-antitoxin system antitoxin VapB Antitoxin
QDY27_RS25770 (5065) 5065..5463 + 399 WP_000911317.1 type II toxin-antitoxin system VapC family toxin Toxin
QDY27_RS25775 (5615) 5615..6805 - 1191 Protein_10 type IV conjugative transfer system coupling protein TraD -
QDY27_RS25780 (7056) 7056..7787 - 732 WP_023565183.1 conjugal transfer complement resistance protein TraT -
QDY27_RS25785 (7819) 7819..8316 - 498 WP_282843564.1 entry exclusion protein -
QDY27_RS25790 (8332) 8332..9366 - 1035 Protein_13 conjugal transfer protein TraG -
QDY27_RS25795 (9364) 9364..9795 + 432 Protein_14 transposase -
QDY27_RS25800 (10093) 10093..10263 + 171 WP_227432179.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - hlyD / hlyC / hlyA / hlyB / hlyD 1..165083 165083
- flank IS/Tn - - 2132..3364 1232
- flank IS/Tn - - 9352..9795 443


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(7-51)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14857.14 Da        Isoelectric Point: 8.5264

>T278007 WP_000911317.1 NZ_CP122834:5065-5463 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS

Download         Length: 399 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8512.55 Da        Isoelectric Point: 4.5358

>AT278007 WP_000450532.1 NZ_CP122834:4838-5065 [Escherichia coli]
METTVFLSNRSQAVRLPKAVALPENVKRVEVIAVGRTRIITPAGETWDEWFDGNSVSADFMDNREQPGMQERESF

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829CHF5

References