Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 19456..20057 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP122833 | ||
| Organism | Escherichia coli strain ETEC1730 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9YA20 |
| Locus tag | QDY27_RS25335 | Protein ID | WP_001216045.1 |
| Coordinates | 19456..19836 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | QDY27_RS25340 | Protein ID | WP_001190712.1 |
| Coordinates | 19836..20057 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QDY27_RS25310 (QDY27_25310) | 14897..16381 | - | 1485 | WP_000124150.1 | terminase | - |
| QDY27_RS25315 (QDY27_25315) | 16381..17574 | - | 1194 | WP_000219616.1 | hypothetical protein | - |
| QDY27_RS25320 (QDY27_25320) | 17660..18112 | - | 453 | WP_032192895.1 | Late promoter-activating protein | - |
| QDY27_RS25325 (QDY27_25325) | 18201..19244 | - | 1044 | WP_072660937.1 | DUF968 domain-containing protein | - |
| QDY27_RS25330 (QDY27_25330) | 19272..19451 | - | 180 | WP_000113018.1 | hypothetical protein | - |
| QDY27_RS25335 (QDY27_25335) | 19456..19836 | - | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QDY27_RS25340 (QDY27_25340) | 19836..20057 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QDY27_RS25345 (QDY27_25345) | 20240..21796 | + | 1557 | WP_086186057.1 | type I restriction-modification system subunit M | - |
| QDY27_RS25350 (QDY27_25350) | 21793..22974 | + | 1182 | WP_120150456.1 | restriction endonuclease subunit S | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..91199 | 91199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T278006 WP_001216045.1 NZ_CP122833:c19836-19456 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLP7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |