Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2577646..2578284 | Replicon | chromosome |
Accession | NZ_CP122832 | ||
Organism | Escherichia coli strain ETEC1730 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | QDY27_RS12700 | Protein ID | WP_000813794.1 |
Coordinates | 2578108..2578284 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QDY27_RS12695 | Protein ID | WP_282843529.1 |
Coordinates | 2577646..2578062 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY27_RS12675 (2572798) | 2572798..2573739 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
QDY27_RS12680 (2573740) | 2573740..2574753 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
QDY27_RS12685 (2574771) | 2574771..2575916 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
QDY27_RS12690 (2576161) | 2576161..2577567 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
QDY27_RS12695 (2577646) | 2577646..2578062 | - | 417 | WP_282843529.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QDY27_RS12700 (2578108) | 2578108..2578284 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QDY27_RS12705 (2578506) | 2578506..2578736 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QDY27_RS12710 (2578828) | 2578828..2580789 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QDY27_RS12715 (2580862) | 2580862..2581398 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
QDY27_RS12720 (2581490) | 2581490..2582665 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T278002 WP_000813794.1 NZ_CP122832:c2578284-2578108 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15197.56 Da Isoelectric Point: 4.7358
>AT278002 WP_282843529.1 NZ_CP122832:c2578062-2577646 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEIAHLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEIAHLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|