Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 913793..914447 | Replicon | chromosome |
Accession | NZ_CP122832 | ||
Organism | Escherichia coli strain ETEC1730 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | QDY27_RS04430 | Protein ID | WP_000244777.1 |
Coordinates | 914040..914447 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QDY27_RS04425 | Protein ID | WP_000354046.1 |
Coordinates | 913793..914059 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDY27_RS04405 (909762) | 909762..911195 | - | 1434 | WP_001514525.1 | 6-phospho-beta-glucosidase BglA | - |
QDY27_RS04410 (911240) | 911240..911551 | + | 312 | WP_001514524.1 | N(4)-acetylcytidine aminohydrolase | - |
QDY27_RS04415 (911715) | 911715..912374 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QDY27_RS04420 (912570) | 912570..913550 | - | 981 | WP_001514522.1 | tRNA-modifying protein YgfZ | - |
QDY27_RS04425 (913793) | 913793..914059 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QDY27_RS04430 (914040) | 914040..914447 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
QDY27_RS04435 (914487) | 914487..915008 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QDY27_RS04440 (915120) | 915120..916016 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QDY27_RS04445 (916041) | 916041..916751 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QDY27_RS04450 (916757) | 916757..918490 | + | 1734 | WP_032187585.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T277996 WP_000244777.1 NZ_CP122832:914040-914447 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |