Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 50875..51434 Replicon plasmid unnamed7
Accession NZ_CP122830
Organism Escherichia coli strain ETEC1732

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag QDX01_RS28385 Protein ID WP_000421257.1
Coordinates 51159..51434 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag QDX01_RS28380 Protein ID WP_001178089.1
Coordinates 50875..51159 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX01_RS28350 (46647) 46647..47237 + 591 WP_012817838.1 DUF2726 domain-containing protein -
QDX01_RS28355 (47392) 47392..47856 + 465 WP_000872610.1 hypothetical protein -
QDX01_RS28360 (48113) 48113..48262 + 150 WP_001378818.1 Hok/Gef family protein -
QDX01_RS28365 (48546) 48546..48794 + 249 WP_000083839.1 replication regulatory protein RepA -
QDX01_RS28370 (49038) 49038..49112 + 75 WP_001365705.1 RepA leader peptide Tap -
QDX01_RS28375 (49105) 49105..49962 + 858 WP_012817826.1 incFII family plasmid replication initiator RepA -
QDX01_RS28380 (50875) 50875..51159 + 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
QDX01_RS28385 (51159) 51159..51434 + 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDX01_RS28390 (51717) 51717..52904 - 1188 WP_000937591.1 IS91 family transposase -
QDX01_RS28395 (52904) 52904..53269 - 366 WP_000091308.1 hypothetical protein -
QDX01_RS28400 (53354) 53354..53548 + 195 Protein_66 carbohydrate transporter -
QDX01_RS28405 (53564) 53564..53734 + 171 WP_162779668.1 hypothetical protein -
QDX01_RS28410 (53765) 53765..54344 + 580 Protein_68 transposase -
QDX01_RS28415 (54648) 54648..55856 - 1209 WP_000198533.1 IS91 family transposase -
QDX01_RS28420 (55837) 55837..56109 - 273 WP_000019163.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - estIa / hlyD / hlyB / hlyB / hlyA / hlyC 1..98230 98230


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T277992 WP_000421257.1 NZ_CP122830:51159-51434 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10456.86 Da        Isoelectric Point: 5.6558

>AT277992 WP_001178089.1 NZ_CP122830:50875-51159 [Escherichia coli]
IQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References