Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 14805..15352 Replicon plasmid unnamed7
Accession NZ_CP122830
Organism Escherichia coli strain ETEC1732

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag QDX01_RS28170 Protein ID WP_001384452.1
Coordinates 15074..15352 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag QDX01_RS28165 Protein ID WP_000079941.1
Coordinates 14805..15074 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX01_RS28135 (9979) 9979..10437 - 459 Protein_13 transposase -
QDX01_RS28140 (10515) 10515..10664 - 150 Protein_14 transposase -
QDX01_RS28145 (11172) 11172..11390 + 219 WP_001353651.1 heat-stable enterotoxin ST-I group a -
QDX01_RS28155 (12974) 12974..13366 - 393 Protein_17 IS21-like element IS21 family helper ATPase IstB -
QDX01_RS28160 (13366) 13366..14538 - 1173 WP_282835500.1 IS21-like element IS21 family transposase -
QDX01_RS28165 (14805) 14805..15074 + 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
QDX01_RS28170 (15074) 15074..15352 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
QDX01_RS28175 (15661) 15661..16803 + 1143 WP_158649904.1 YiiX/YebB-like N1pC/P60 family cysteine hydrolase -
QDX01_RS28180 (16776) 16776..16880 + 105 Protein_22 hypothetical protein -
QDX01_RS28185 (16892) 16892..17803 + 912 WP_024244186.1 toll/interleukin-1 receptor domain-containing protein -
QDX01_RS28190 (17945) 17945..18339 - 395 Protein_24 plasmid partitioning/stability family protein -
QDX01_RS28195 (18339) 18339..19298 - 960 WP_000921958.1 plasmid segregation protein ParM -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - estIa / hlyD / hlyB / hlyB / hlyA / hlyC 1..98230 98230


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T277988 WP_001384452.1 NZ_CP122830:15074-15352 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT277988 WP_000079941.1 NZ_CP122830:14805-15074 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References