Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 7077..7678 Replicon plasmid unnamed5
Accession NZ_CP122828
Organism Escherichia coli strain ETEC1732

Toxin (Protein)


Gene name doc Uniprot ID A0A731GHK2
Locus tag QDX01_RS27105 Protein ID WP_001216038.1
Coordinates 7077..7457 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QDX01_RS27110 Protein ID WP_001190712.1
Coordinates 7457..7678 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDX01_RS27070 (QDX01_27070) 2969..3997 + 1029 WP_001292231.1 tyrosine-type recombinase/integrase -
QDX01_RS27075 (QDX01_27075) 4071..4415 + 345 WP_001191776.1 hypothetical protein -
QDX01_RS27080 (QDX01_27080) 4412..4876 + 465 WP_282835462.1 hypothetical protein -
QDX01_RS27085 (QDX01_27085) 4873..5367 + 495 WP_074525592.1 dUTP diphosphatase -
QDX01_RS27090 (QDX01_27090) 5382..6059 + 678 WP_001061873.1 DUF2829 domain-containing protein -
QDX01_RS27095 (QDX01_27095) 6066..6842 + 777 WP_282835463.1 hypothetical protein -
QDX01_RS27100 (QDX01_27100) 6875..7072 - 198 WP_000113017.1 hypothetical protein -
QDX01_RS27105 (QDX01_27105) 7077..7457 - 381 WP_001216038.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QDX01_RS27110 (QDX01_27110) 7457..7678 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDX01_RS27115 (QDX01_27115) 7787..8209 - 423 WP_000098854.1 hypothetical protein -
QDX01_RS27120 (QDX01_27120) 8344..8733 - 390 WP_022630896.1 S24 family peptidase -
QDX01_RS27125 (QDX01_27125) 8793..8891 - 99 Protein_14 DNA polymerase III subunit theta -
QDX01_RS27130 (QDX01_27130) 8924..9274 + 351 WP_001436207.1 hypothetical protein -
QDX01_RS27135 (QDX01_27135) 9381..9533 - 153 WP_022630897.1 hypothetical protein -
QDX01_RS27140 (QDX01_27140) 9517..10401 - 885 WP_236419076.1 hypothetical protein -
QDX01_RS27145 (QDX01_27145) 10474..10599 - 126 Protein_18 hypothetical protein -
QDX01_RS27150 (QDX01_27150) 10952..11635 - 684 WP_282835464.1 ead/Ea22-like family protein -
QDX01_RS27155 (QDX01_27155) 11632..12330 - 699 WP_119799329.1 ead/Ea22-like family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..90359 90359


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13574.27 Da        Isoelectric Point: 5.1514

>T277984 WP_001216038.1 NZ_CP122828:c7457-7077 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEISDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT277984 WP_001190712.1 NZ_CP122828:c7678-7457 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A731GHK2

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References